SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011606 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011606
Domain Number 1 Region: 210-355
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.84e-31
Family AlaX-like 0.018
Further Details:      
 
Domain Number 2 Region: 151-208
Classification Level Classification E-value
Superfamily Translation proteins 0.0000000006
Family AlaX-M N-terminal domain-like 0.0027
Further Details:      
 
Domain Number 3 Region: 2-54
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.00000356
Family Co-chaperone p23-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011606   Gene: ENSOPRG00000012708   Transcript: ENSOPRT00000012710
Sequence length 523
Comment pep:novel genescaffold:pika:GeneScaffold_3109:283400:302149:-1 gene:ENSOPRG00000012708 transcript:ENSOPRT00000012710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFCVEDSTDVQVVIEDHRLMFSCKNADGVELHNEIEFYAKVNCKDSDKRSSRSIXXXXX
XXXXXXXXXXXXXXXXXPVWLSVDFDNWRDWEGDEEVELAQVEQYAELLTKVSTKRAPPA
MDDLDFTTTVVSCSPAELQVEGGSGKKDVLSGFQVVLEDTLLFPEGGGQPDDRGTIDGIP
VLRVTRRGAQADHFTQTALTPGSQVQVCVDWERRFDHMQQHSGQHLITAVADHLFGLKTT
SWELGRLRSVIELDSPSVSAEQAAAIEQSVNEKIRGRLPVSVHELSLDDPEVEQVRGRGL
PDDHAGPIRVVTIEGVDSNMCCGTHVSNLSDLQVIKILGTEKGKKNKTNLLFLAGNRVLK
WMERSHGTERALTALLKCGAEDHVEAVKKLQSCTKLLQKNNLSLLRDLAVHVAHSLRSSP
DWGGVVALHRKEADSEFMNIIANEIGSEGTLLFLTVGDEKGAGLFLLAGPAEAVETLGPR
VAELEGKGAGKRGRFQGKATKMSRRAEVQALLQDYVSAQSAEE
Download sequence
Identical sequences ENSOPRP00000011606 ENSOPRP00000011606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]