SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011631 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011631
Domain Number 1 Region: 32-143
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.02e-42
Family Frizzled cysteine-rich domain 0.000000805
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000011631
Domain Number - Region: 221-470
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00558
Family Rhodopsin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011631   Gene: ENSOPRG00000012748   Transcript: ENSOPRT00000012737
Sequence length 589
Comment pep:novel scaffold:pika:scaffold_10733:3418:5187:-1 gene:ENSOPRG00000012748 transcript:ENSOPRT00000012737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARPEPSAPPSLLLLLLAQLAGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRHFPAKPTAAGPPGVPAAGT
ECAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIASYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTLESWRRFTSRCCCR
HSRRGHKNGGAMAAGDYAEASAALTGRTGPPGPATGAAAYHKQVSLSHV
Download sequence
Identical sequences ENSOPRP00000011631 ENSOPRP00000011631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]