SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011777 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011777
Domain Number 1 Region: 2-101
Classification Level Classification E-value
Superfamily TIMP-like 1.59e-36
Family Tissue inhibitor of metalloproteinases, TIMP 0.00000548
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011777   Gene: ENSOPRG00000012909   Transcript: ENSOPRT00000012898
Sequence length 106
Comment pep:novel scaffold:pika:scaffold_76157:4:1346:1 gene:ENSOPRG00000012909 transcript:ENSOPRT00000012898 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSEEFLIAGQLRKGLLHINTCSFVVPWNSLSSSQRSGFTKTYAAGCDMCKVFACASIPCH
LESNTHCLWTDQLLLGSEKGFQSRHLACLPREPGLCVWQSLRPRKD
Download sequence
Identical sequences ENSOPRP00000011777 ENSOPRP00000011777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]