SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012461 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012461
Domain Number 1 Region: 224-260
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000142
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 
Domain Number 2 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000017
Family CCCH zinc finger 0.0045
Further Details:      
 
Domain Number 3 Region: 145-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000445
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000012461
Domain Number - Region: 38-59
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00105
Family CCCH zinc finger 0.0058
Further Details:      
 
Domain Number - Region: 119-143
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00455
Family CCCH zinc finger 0.0069
Further Details:      
 
Domain Number - Region: 90-118
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0288
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012461   Gene: ENSOPRG00000013663   Transcript: ENSOPRT00000013657
Sequence length 269
Comment pep:novel genescaffold:pika:GeneScaffold_1938:47440:59857:1 gene:ENSOPRG00000013663 transcript:ENSOPRT00000013657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGIDKSGAAVCEFFLKAACGKGGMCPFRHI
SGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESK
IKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPP
LPQQTQPPSKQSNNPPLQRSSSLIQLTSQNSSPNQQRAPQVIGVMQSQNSSAGNRGPRPL
EQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Download sequence
Identical sequences ENSOPRP00000012461 ENSOPRP00000012461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]