SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012699 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012699
Domain Number 1 Region: 47-101
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 6.67e-16
Family Frizzled cysteine-rich domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012699   Gene: ENSOPRG00000013932   Transcript: ENSOPRT00000013918
Sequence length 540
Comment pep:novel genescaffold:pika:GeneScaffold_418:899079:903411:-1 gene:ENSOPRG00000013932 transcript:ENSOPRT00000013918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWRGAGPSAPGAPGGAGLRLGLLLLLLLLLQLLGPARGFGDEEERRCDPIRISMCQNLG
YNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLYSFHXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGL
KNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAV
KTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIR
SNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVE
MLKIFMSLLVGITSGMWIWSAKTLHTWQRCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
Download sequence
Identical sequences ENSOPRP00000012699 ENSOPRP00000012699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]