SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000012766 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000012766
Domain Number 1 Region: 54-133
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000281
Family I set domains 0.00033
Further Details:      
 
Domain Number 2 Region: 138-220
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000165
Family I set domains 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000012766   Gene: ENSOPRG00000013989   Transcript: ENSOPRT00000013986
Sequence length 262
Comment pep:novel genescaffold:pika:GeneScaffold_2627:4353:11957:1 gene:ENSOPRG00000013989 transcript:ENSOPRT00000013986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGGKAGLLPSPFWVGPLLISVTHSRQCCSMGQLLSPVALLLLVSAASQAAEDLKPVVLLD
PPWDRVLQDDRVTLKCQGVPPAANSSIQWLHNGSLISSHAPTYTITSARAEDSGEYRCGT
NISTLSDPVQLHVRVGWLVLQAARWVIQEGEPIHLRCHSWRNKPVYKVIYLHNGRGVKYF
HYNTDLHIPEAKRTFSGSYCCTGHIGKSNVFSETVIITVEGAANPSISPSVLPWHLIAFG
LVMGLLLAVDTALYFSVKRDLR
Download sequence
Identical sequences ENSOPRP00000012766 ENSOPRP00000012766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]