SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000013549 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000013549
Domain Number 1 Region: 161-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.8e-34
Family G proteins 0.0046
Further Details:      
 
Domain Number 2 Region: 486-574
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 2.66e-19
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0033
Further Details:      
 
Domain Number 3 Region: 391-482
Classification Level Classification E-value
Superfamily Translation proteins 1.46e-16
Family Elongation factors 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000013549   Gene: ENSOPRG00000014827   Transcript: ENSOPRT00000014836
Sequence length 669
Comment pep:novel genescaffold:pika:GeneScaffold_721:208269:227527:1 gene:ENSOPRG00000014827 transcript:ENSOPRT00000014836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAERSRSPMDSPVPASMFAPEPSSPGAARAAAAAARLHGGFDSDCSEDGEALNGEPELD
LTSKLVLVSPSAEQYDSLLRQMWERMDEGCGETIYVIGQGSDGTEYGLSEADMEASYATV
KSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRVAVVGNVDAGKSTLLGVL
THGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEGNVVNKPDSHGGSLEWTKI
CEKSTKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGSNAGIVGMTKEHLGLALALN
VPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVLVQNKDDVIVTASNFSSERMC
PIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQIDDTYSVPGVGTVVSGTTLRGL
IKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGGQTASFALKKIKRSSIRKGMVMV
SPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGSIRQTATILSMDKDCLRTGDKATV
HFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQTTNNSPMNSKPQQIKMQSTKKGPLT
KRDEGGPPGGPVVGAAAPGDEVASLGAAQLAASSGLLPQPKPSSGGRRRGGQRHKGKSQG
ACVTPASGC
Download sequence
Identical sequences ENSOPRP00000013549 XP_004589553.1.84141 ENSOPRP00000013549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]