SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014213 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014213
Domain Number 1 Region: 151-324,377-570
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 9.89e-91
Family Phosphonoacetate hydrolase 0.013
Further Details:      
 
Domain Number 2 Region: 647-761
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000000000000129
Family DNA/RNA non-specific endonuclease 0.018
Further Details:      
 
Domain Number 3 Region: 57-103
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000366
Family Somatomedin B domain 0.0017
Further Details:      
 
Domain Number 4 Region: 105-146
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000127
Family Somatomedin B domain 0.0029
Further Details:      
 
Domain Number 5 Region: 808-913
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.0000306
Family DNA/RNA non-specific endonuclease 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014213   Gene: ENSOPRG00000015551   Transcript: ENSOPRT00000015562
Sequence length 915
Comment pep:novel genescaffold:pika:GeneScaffold_2306:74362:176536:-1 gene:ENSOPRG00000015551 transcript:ENSOPRT00000015562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRSSLHFYQIMSLFTFALGVNICLGFTASRIKRAEGWDEGLPTEMSDSPWTNISGSCK
GRCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTARGWECTKDRCGEVRNEENACHC
SEDCLARGDCCTNYQGICKGESHWVDDECEEIKAPECPAGFVRPPLIIFSVDGFRASYMK
KGSKVMPNIEKLRSCGTHAPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDA
TFHLRGREKFNHRWWGGQPLWITSIKQGVRAGTFFWSVVIPHERRILTILQWLTLPDNER
PSVYAFYSEQPDFSGHKYGPFGPEXSSYGPPLSPAKRPKRKVAPKRRQQRPVSPPKKRRR
KLPSIDQDAAESRQDKMTNPLREIDKTVGQLMDGLKQLNLHRCVNVIFVGDHGMEDVTCD
RTEFLSNYLTNVDDITLVPGTLGRIRSKFSNNPKYDPKAIIANLTCKKPDQHFKPYLKQH
LPKRLHYANNRRIEDIHLLVERRWHVARKPLDVYKKPTGKCFFQGDHGFDNKVNSMQTVF
VGYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRVNTFRPTMPEEV
TRPNYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHTKGSTEERHLLYGRPAVLYRT
RYDILYHTDFESGYSEIFLMPLWTSYTVSKQAEVSGIPEHLTNCVRPDVRISPSFSQNCL
AYKNDKQMSYGFLFPPYLSSSPEAKYEAFLVTNMDPMYPAFEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXYVEGSPIPVPTHYYSIITSCLDFTQPADKCDGP
LSVSSFILPHRADNDESCNSSEDESRWVEDLIKMHTARVRDIEHLTSLVFYGKTSRSYPE
ILTLKTYLHTYESEI
Download sequence
Identical sequences ENSOPRP00000014213 ENSOPRP00000014213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]