SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000014917 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000014917
Domain Number 1 Region: 114-439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.29e-65
Family G proteins 0.0000167
Further Details:      
 
Domain Number 2 Region: 681-828
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.34e-48
Family Translational machinery components 0.000039
Further Details:      
 
Domain Number 3 Region: 443-568
Classification Level Classification E-value
Superfamily Translation proteins 8.17e-35
Family Elongation factors 0.00034
Further Details:      
 
Domain Number 4 Region: 829-915
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.44e-26
Family EF-G/eEF-2 domains III and V 0.00025
Further Details:      
 
Domain Number 5 Region: 585-654
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 2.27e-16
Family EF-G/eEF-2 domains III and V 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000014917   Gene: ENSOPRG00000016323   Transcript: ENSOPRT00000016335
Sequence length 972
Comment pep:novel genescaffold:pika:GeneScaffold_405:85569:124862:-1 gene:ENSOPRG00000016323 transcript:ENSOPRT00000016335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDEDDDDIGDHDEDHPGMEVVLH
EDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLA
DLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVG
IKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLIL
SPLLGNVCFSSSQYSICFTLGSFAKIYADTFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVC
KKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIE
VNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSEL
PKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLC
DELIRNVKFKILDAMVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPA
DCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSV
FHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
Download sequence
Identical sequences ENSOPRP00000014917 ENSOPRP00000014917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]