SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015404 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015404
Domain Number 1 Region: 730-787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.98e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 31-72
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000144
Family Somatomedin B domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015404   Gene: ENSOPRG00000016867   Transcript: ENSOPRT00000016870
Sequence length 830
Comment pep:novel genescaffold:pika:GeneScaffold_5482:44996:51355:1 gene:ENSOPRG00000016867 transcript:ENSOPRT00000016870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPALLPWTLRLLLLLALTPGPGPRPVAVAQSSCSLRCGDQNGSCSCHPTCSGLDTCCAD
FQDFCLKISPYSGSLMGGKDFVVQHLTWPGPADGVICRFKDSIDTLGHVDSSGQVHCVSP
LLYESGHIPFNISLDGGVSFPRSGTWLSVHQNKVSDSEKGQLVNETRWQYYGTAGTTGNL
SLTWNSTVLSTPYVRIELWGYDETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNVQDIWINEHALAWHLDDDFRRDPVGWARQECLAWER
VDDEMPNFLQELPDCPCTLAQARADTGRFHTDYGCDIEHGSVCTYHPGAVHCVRSVQPST
RYGSGQQCCYIADGTQLLTADSTSGSTPDRGHDWGAPPLRQPPRIPGMSHWSYDVINFYY
CCLWAPECPRYMQRTTIQRLPSCNCRNCSLPRLTSAFGDPHFVTFDGTSFTFNGRGEYVL
IQASPSDLRVQARAQPGTTFNGTTARATGLTSVAVQEHDSDVVEVRLAEGTGVLQVLLNQ
EVLSFAEQNWMDLKGMFLSVAASDKVSIMLASGAGLEVAVQGPFLSVSVLLPESFLNHTH
GLLGTLNGDPSDDFTLRSGQVLPPSASAEQLLQFGADWAVDNTSSLLTYDSQFLVQNFLV
RPKHDPDFRPLFPGETTLSPGQEEEVARLCGDDQFCRFDVLATGSLSVGNATRAAHQQHW
SLVQSLQPVVTCGWLAPPANGSKEGMRYTLGSTVHFSCNNGFSLAGAQSSTCQADGTWSA
PTPECRQTGRSNTVLLSVIFGSLGVVAVVILVYLLLRHRKGGMKMWSSQP
Download sequence
Identical sequences ENSOPRP00000015404 ENSOPRP00000015404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]