SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015642 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015642
Domain Number 1 Region: 201-272,299-580
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 3.78e-77
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.08
Further Details:      
 
Domain Number 2 Region: 671-868
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.00000000000133
Family DNA/RNA non-specific endonuclease 0.013
Further Details:      
 
Domain Number 3 Region: 108-153
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000837
Family Somatomedin B domain 0.0021
Further Details:      
 
Domain Number 4 Region: 154-195
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000615
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015642   Gene: ENSOPRG00000017133   Transcript: ENSOPRT00000017136
Sequence length 872
Comment pep:novel genescaffold:pika:GeneScaffold_4974:4586:80788:1 gene:ENSOPRG00000017133 transcript:ENSOPRT00000017136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDGCAGGGSQGGGVGKGVHVSREGPAGNGRDRSHGQAAGTPGDPQAAASLLAPMDLGE
EPLEKAARGRTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTF
GNCRCDVACVDLGNCCLDYQETCIEPERIWTCNKFRCGEKRLSRSLCACSDDCKERGDCC
INYSAVCQGEKSWVEETCESIDEPQCPKGFEVPPTLLFSLDGFRAEYLHTWGGLLPVISK
LKKCGTYTKNIRPVYPTKTFPNHYSIVTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXIWLTAKYQGLRSGTFFWPGSDVKINGIFPDIYKIYNGSVPFEERILAVLQWL
QLPKDERPHFYTLYLEEPDSSGHSYGPVSSEVIKALQRVDNMVGMLMDGLKELNLHQCLN
LILISDHGMEQGSCKKYIYLNKYLGDTKNIKVIYGPAARLRPSDVPDKYYSFNYESVARN
LSCREPNQHFKPYLKHFLPKRLHFAKSDRIEPLTFYLDSQXXXXXNPSERKYCGSGFHGS
DNVFSNMQALFVGYGPAFQHGIEVDSFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKN
PVYTPKHPKEVQPLVQCPFTGLSTDGLGCSCNHSIMPIVDFQTQLNLTTAEEKSINRASL
PYGRPRVLQKKTSVCLLYQHQFVSGYSHDILMPLWTSYTISRNDSFSTKDFSNCLYQDLR
ISLSPVHNCSLYKNNAKLSYGFLSPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXIWRYLH
DILLRRYAEERNGVNVVSGPVFDSDYDGRYDLAEALRKNSRIIRNQEILIPTHFFIVITS
CKDTSQTPLQCDSLDPLAFIVPHRPDNSESCV
Download sequence
Identical sequences ENSOPRP00000015642 ENSOPRP00000015642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]