SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000015760 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000015760
Domain Number 1 Region: 980-1071
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.09e-21
Family Alpha-macroglobulin receptor domain 0.0038
Further Details:      
 
Domain Number 2 Region: 244-315
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 4.19e-20
Family Anaphylotoxins (complement system) 0.0000498
Further Details:      
 
Domain Number 3 Region: 1067-1168
Classification Level Classification E-value
Superfamily TIMP-like 0.0000000018
Family Netrin-like domain (NTR/C345C module) 0.000062
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000015760
Domain Number - Region: 383-414
Classification Level Classification E-value
Superfamily E set domains 0.0756
Family SVA-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000015760   Gene: ENSOPRG00000017264   Transcript: ENSOPRT00000017267
Sequence length 1171
Comment pep:novel genescaffold:pika:GeneScaffold_5316:33:53246:-1 gene:ENSOPRG00000017264 transcript:ENSOPRT00000017267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNTNAPDLPEENQASKTFQAVTYSSLSQSYLYIDWTENYKALLVGQHLNLLVTPRSPYID
KITHYNYLILSKGKIVHFGTREKLSDSSYQSINIPVTQNMVPSARLLVYYIITGEQTAEL
VSDSVWLNIEEKCGNQLQVRLFPGVDASPGQSVSLSMETESHSWVALTAVDSAVYSVQRT
TKKPMERVFQAFEKSDLGCGAGGGRNNADVFRLAGLTFLTNANADDSQESDVPCKEILRP
KRTLLEKINKAAAKYKHKMIKDCCYHGAHLNKDESCEQRAARITIGPKCVKAFSECCIIA
TEFRANMSHKNIQLGRLHTMPLLPVSKPEVRSYFPESWLWEVHHVSRRSQLQLVLPDSLT
TWEIQGVGISDSGLCVADTLKAKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMMX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXPEGVKRESHAGVTLDPKGIYGVISRRKEFPYRIPLDLVPKTNVQR
ILSVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXYKANKEDSPSGSSHAVMDISLPTGISANQDDLRALVEGVDQLLTDYQI
KDGHVILQVNSIPSGDFLCVRFRIFELFQVGYLSPATFTVYEYHRPESDCGQMKEELDLT
ISANTRRETACKPEIAYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAVAQKGSEITFIK
KTTCANADLVKGRQYLLMGKEALQIKYNFNI
Download sequence
Identical sequences ENSOPRP00000015760 ENSOPRP00000015760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]