SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000121 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000121
Domain Number 1 Region: 332-364
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000085
Family CCCH zinc finger 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000121   Gene: ENSOPRG00000000135   Transcript: ENSOPRT00000000135
Sequence length 1047
Comment pep:novel genescaffold:pika:GeneScaffold_2860:41635:81275:-1 gene:ENSOPRG00000000135 transcript:ENSOPRT00000000135 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPDHQSIKLSNLGENKHYEVAKKCVEDLALYLKPLSGGKGIASLNQSALCHTMQRKLVTL
VNCQLVEEEGRVRAMRAARSLGERTVTELILQHQNPQQLSANLWAAVRARGCQFLGPAMQ
EEALKLVLLALEDGSALSRKVLVLFVVQRLEPRFPQASKTSIGHVVQLLYRASCFKVTKR
DEDSSLMQLKEEFRSYEALRREHDAQIVHIAMEAGLRISPEQWSSLLYGDLAHKSHMQSI
IDKLQSPESFAKSVQELTIVLQRTGDPANLNRLRPHLELLANIDPNPDAVSPTWEQLENA
MVAVKTVVHGLVDFIQNYSRKGHEAPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQ
EELEKYRLRNKKINATVRTFPLLNKVGVNNTVTTTAGNVISVIGSTETTGKIVPSSNGIS
SAENSASQLIPRSTDNTLRTLETVKKVGKAGTNGQNAAGPAAESVTENKIGSPPKTPVSH
VAATSAGPSNVGTELSSVPPKSSAFLTRVPVYPQHSENIQYFQDPRTQIPFEVPQYPQTX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASMPYADHYSTFSPRDRMNSSPYQPPPP
QPYGPVPPVPSGMYAPVYDSRRIWRPPMYQRDDIIRSNSLPPMDVMHSSVYQTSLRERYN
SLDGYYSVACQPPSEPRTTVPLPREPCGHLKTSCEEQIRRKPDQWAQYHTQKAPVSSTLP
VATQSPTPPSPLFSVDFRTDFSESVSGTKFEDDHLSHYSPWSCGTIGSCINAIDSEPKDV
IANSNAVLMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXYVPYVNAVDSRWSSCSSETTSSAHYVERDRFIVADLSSH
RKHSSTGDLLSLELQQAKSNSLLLQREANALAMQQKWNSLDEGRHLTLNLLSKEIELRNG
ELQSDYTEDAADTKPDRDIELELSALDTDEPDGQSEQIEEILDMQLGISSQNDQLLNGTA
VENGHPAQHQKESLKQKRQSLGEDPVI
Download sequence
Identical sequences ENSOPRP00000000121 ENSOPRP00000000121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]