SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000454 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000454
Domain Number 1 Region: 56-291
Classification Level Classification E-value
Superfamily Translation proteins 1.85e-55
Family Ribosomal protein L3 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000454   Gene: ENSOPRG00000000501   Transcript: ENSOPRT00000000496
Sequence length 316
Comment pep:novel genescaffold:pika:GeneScaffold_5031:439508:539321:-1 gene:ENSOPRG00000000501 transcript:ENSOPRT00000000496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THVWSFVRSLHGKSGTWWDEHLSEENVPFVKQLVSDEDKAQLASKLCPLKDELSLHPWEP
GSSRVGLIALKLGMMPLWTKDGRRHVATLLQVQDCHVLKYTSKENHNGKMAALTVGGKTV
SRFWKSPSILEFYRELGLPPKQKVKIFHVTDNAVIKPGTPLYAAHFRPGQYVDVTAKTIG
KGFQGVMKRWGFKGQPATHGQTKTHRRPGAISTGXXXXXXXXXXXXXXXXXXXXXXXXXX
VWRINTKHNIIYVNGSVPGHKNSLVKVRDSNLPAYKDFCKNLPFPTYFPDGDGEELPEDL
YDEDVCQPSAPSITFA
Download sequence
Identical sequences ENSOPRP00000000454 ENSOPRP00000000454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]