SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000000769 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000000769
Domain Number 1 Region: 232-332,359-524
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.08e-72
Family Protein kinases, catalytic subunit 0.000000000477
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 9.15e-40
Family SH2 domain 0.00000129
Further Details:      
 
Domain Number 3 Region: 52-172
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-24
Family SH3-domain 0.0000388
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000000769   Gene: ENSOPRG00000000835   Transcript: ENSOPRT00000000838
Sequence length 534
Comment pep:novel genescaffold:pika:GeneScaffold_551:121582:129543:1 gene:ENSOPRG00000000835 transcript:ENSOPRT00000000838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSCSSNPEDDWMENIDVCENCHYPIVPLEGKSMLLMRNGSEVRDPLVTYEGSIPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRVLEQNGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNTPDGLCTRLSRPCQTSKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENAQLRDKGQRASPWDGLGQQLSLLPTGSLVDFLKTPSGIK
LTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIEDNEYT
AREGAKFPIKWTAPEAINYGTFTIKSDVRSFGILLTEIVTHGRIPYPGMTNPEVIQNLER
GYRMVRPDNCPEELYQLMKLCWKERPEERPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences ENSOPRP00000000769 ENSOPRP00000000769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]