SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000001965 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000001965
Domain Number 1 Region: 476-552
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000135
Family SH2 domain 0.0028
Further Details:      
 
Domain Number 2 Region: 91-135
Classification Level Classification E-value
Superfamily PH domain-like 0.000000202
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000001965   Gene: ENSOPRG00000002124   Transcript: ENSOPRT00000002131
Sequence length 558
Comment pep:novel genescaffold:pika:GeneScaffold_581:658:8836:1 gene:ENSOPRG00000002124 transcript:ENSOPRT00000002131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEETHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEDERKS
WMALLRREIGHFHERKELPLDASDSSSDTDSFYGVVERPVDISLSSYPTDNEDYERDDED
DSYMEPDSPEPARLEDLTCPPAYPPPPVPTPRKPAFSDLPRAHSFTSKGSSPLIPPPPPK
RGLPDSGPALEDSKRDPLGPKRAEPGLRVPAPSRRMNDPPAGTAPPVPNLRKPPCLRENA
GPSPEPWAPSHGVSPAALAAAAATSRNCDKLKSFHLSARGPPTSEPPPVPTNKPKFLKTV
EVAPPGQVARPGLFAPPVAPRPPALKLPMPEVTARPTVLPRPEKPALPCLQRSPPDGQSF
RSFSFEKPRLPSPAGTEGVDSDEDYEKVPLPSSVFINTTESCEVERLFKTTSPQGVPQDG
LYGIRNSSTKSGKVLVVWDETSNKVRNYRIFEKDSKFYLEGEVLFVSIGSLVEHYYRHVL
PGHQSLLLRHPYGYAAPR
Download sequence
Identical sequences ENSOPRP00000001965 ENSOPRP00000001965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]