SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002527 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002527
Domain Number 1 Region: 112-227
Classification Level Classification E-value
Superfamily SH2 domain 6.75e-36
Family SH2 domain 0.00000927
Further Details:      
 
Domain Number 2 Region: 324-410
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-27
Family Protein kinases, catalytic subunit 0.0000262
Further Details:      
 
Domain Number 3 Region: 73-116
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000986
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002527   Gene: ENSOPRG00000002743   Transcript: ENSOPRT00000002742
Sequence length 414
Comment pep:novel genescaffold:pika:GeneScaffold_1:57494:69986:-1 gene:ENSOPRG00000002743 transcript:ENSOPRT00000002742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCLFCKKLERGSKEDDGLEGNFRASGAANRYGPDPTQGRPASSFTHIPNYNSFSPQPTS
HTFLGASNVKGISGSGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSLSS
GQTGYIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLCPGNPQGTFLVRESETTKGAYSL
SIRDWDPSRGEHVKHYKIRKLDTGGYYITTRVQFDSVQELVKHYRXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXSEEPIYIVTEYMCHGSLLEFLKDQEGQDLKLPQLVDM
AAQVAEGMAYVERMNYIHRDLRAANILVGERLVCKIADFGLARLITDDEYNPRQ
Download sequence
Identical sequences ENSOPRP00000002527 ENSOPRP00000002527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]