SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002656 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOPRP00000002656
Domain Number - Region: 333-421
Classification Level Classification E-value
Superfamily Tropomyosin 0.0589
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002656   Gene: ENSOPRG00000002881   Transcript: ENSOPRT00000002884
Sequence length 506
Comment pep:novel genescaffold:pika:GeneScaffold_3902:50448:74994:-1 gene:ENSOPRG00000002881 transcript:ENSOPRT00000002884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFNFGAPSGTSGTAAATAAPTGGFGGFGTTSTTAGSAFSFSAPANTGTTGLFSQNKGFG
FGTGFGTTTGTSTGLGTGLGTGLGFGGFNTQQQQQPSXXXXXXXXXXXXXXXSNQLINTA
SALSAPTLLGDERDAILAKWNQLQAFWGAGKGYFNNNIPPVEFTQENPFCRFKAVGYSCM
PNNKDEDGLVVLVFVKKEAEIRSQQQQLVESLHKVLGGNQTLTVNVEGIKTLPDDQTEVV
IYVVERSPNGTSRRVPATTLYAHFEQVSIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPP
AGVDPIIWEQAKVDNPDSEKLIPVPMVGFRELLRRLKVQDQMTKQHQTRLDIISEDISEL
QKNQTTTMAKIAQYKRKLMDLSHRTLQVLIKQEIQRKSGYAIQADEEQLRVQLDTIQCEL
NAPTQFKGRLNELMSQIRMQNHFGAVKTEERYYIDADLLREIKQHLKQQQEGLSHLISII
KDDLEDIKLVEHGLNEGIHIRGGVFS
Download sequence
Identical sequences ENSOPRP00000002656 ENSOPRP00000002656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]