SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000002903 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000002903
Domain Number 1 Region: 597-882
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-80
Family Protein kinases, catalytic subunit 0.00000000343
Further Details:      
 
Domain Number 2 Region: 2-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.93e-69
Family Ephrin receptor ligand binding domain 0.00000185
Further Details:      
 
Domain Number 3 Region: 296-503
Classification Level Classification E-value
Superfamily Fibronectin type III 5.84e-41
Family Fibronectin type III 0.0000041
Further Details:      
 
Domain Number 4 Region: 900-964
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.65e-19
Family SAM (sterile alpha motif) domain 0.0000387
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000002903
Domain Number - Region: 227-293,328-348
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00145
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000002903   Gene: ENSOPRG00000003146   Transcript: ENSOPRT00000003159
Sequence length 970
Comment pep:novel genescaffold:pika:GeneScaffold_4618:69685:93374:1 gene:ENSOPRG00000003146 transcript:ENSOPRT00000003159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLLDTSTIHGDWGWLTYPAHGWDSINEVDESFQPIHTYQVCNVMSPNQNNWLRTSWVPRD
GARRVYAEIKFTLRDCNSMPGVLGTCKETFNLYYLESDRDLGSSTQESQFLKIDTIAADE
SFTGADLGVRRLKLNTEVRGVGPLSKRGFYLAFQDIGACLAILSLRIYYKKCPAMVRNLA
AFSEAVTGADSSSLVEVRGQCVRHSEERDTPKMYCSAEGEWLVPIGKCVCSAGYEERRDA
CVACELGFYKSAPGDQLCARCPPHSHSAAPAAQACRCDLSYYRAALDPPSAACTRPPSAP
VNLISSVNGTSVTLEWAPPLDPGGRSDITYNAVCRRCPWALSHCEACGSGPRFVPQQTSL
VQASLLVANLLAHMNYSFWIEAVNGVSDLSPEPRRAAVVNITTNQAAPSQVVVIRQERAG
QTSVSLLWQEPEQPNGIILEYEIKYYEKDKEMQSYSTLKAVTTSATVSGLKPGTRYVFQV
RARTSAGCGRFSQAMEVETGKPRPRYDTRTIVWICLTLITGLVVLLVLLICKKRHCGYSK
AFQDSDEEKMHYQSGQAPPPVFLPLHHPPGKLPEPQFYAEPHNYEEPGRAGRGFTREIEA
SRIHIEKIIGSGESGEVCYGWLRVPGQRDVPVAIKALKAGYTERQRRDFLSEASIMGQFD
HPNIIRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQFTIMQLVGMLRGVGAGMRYLS
DLGYVHRDLAARNVLVDGNLVCKVSDFGLSRVLEDDAEAAYTTTGGKIPIRWTAPEAIAF
RTFSSASDVWSFGVVMWEVLAYGERPYWNMTNRDVISSVEEGYRLPAPMGCPRALHQLML
DCWHKDRAQRPRFSHIVSVLDALIRSPESLRATATTSRCPPPAFARSCFDLRAGGGGGLT
VGDWLDSIRMGRYRDHFAAGGYSSLGMVLRMNAQDVRALGITLMGHQKKILGSIQTMRAQ
LSSTQGRRHL
Download sequence
Identical sequences ENSOPRP00000002903 ENSOPRP00000002903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]