SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003108 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003108
Domain Number 1 Region: 15-175
Classification Level Classification E-value
Superfamily C-type lectin-like 1.68e-33
Family C-type lectin domain 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003108   Gene: ENSOPRG00000003399   Transcript: ENSOPRT00000003389
Sequence length 176
Comment pep:novel genescaffold:pika:GeneScaffold_5226:53:19015:1 gene:ENSOPRG00000003399 transcript:ENSOPRT00000003389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRKVLWRFVSGTLGLCLLLMTTLGIVMKNVFSKPSNQSTFSPEVTIELQEGSDCCSCPDK
WIGYQCNCYFFSDKAKTWRESGHLCGIQNSSLLKLQSEDELQRFMSSNQDFYWIGLSYQE
EYGAWLWEDGSAVSQDLFQMFQSLTPKDCVVYASSKVVLNENCEKNYPYICKKRLI
Download sequence
Identical sequences ENSOPRP00000003108 ENSOPRP00000003108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]