SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003203 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003203
Domain Number 1 Region: 227-296
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000843
Family RING finger domain, C3HC4 0.039
Further Details:      
 
Domain Number 2 Region: 32-56
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000144
Family CCCH zinc finger 0.0043
Further Details:      
 
Domain Number 3 Region: 3-27
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000327
Family CCCH zinc finger 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000003203
Domain Number - Region: 322-350
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000471
Family CCCH zinc finger 0.0035
Further Details:      
 
Domain Number - Region: 165-188
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00173
Family CCCH zinc finger 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003203   Gene: ENSOPRG00000003501   Transcript: ENSOPRT00000003489
Sequence length 414
Comment pep:novel genescaffold:pika:GeneScaffold_2705:614816:633393:1 gene:ENSOPRG00000003501 transcript:ENSOPRT00000003489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTKQVTCRYFMHGVCREGSQCLFSHDLANSKPSTICKYYQKGYCAYGTRCRYDHTRPSA
AAAGAGGALPPAGPSAGFHSPRASDLTVSLKTHPPEPGKREKRTLVLRDRNLSGLAEEKS
PPSVASGAGGCSDAHRSLEAKPHSYLDAIRSGLDELEAGSSCGGEQQLCPYAAAGTCRFG
AACVYLHGDVCEICRLPVLHPFDPEQRKEHEKKCMSTFEHDMEKAFALQASQDKVCSICM
EVILEKASASERRFGILSNCNHTYCLACIRQWRCAKQFENPIIKSCPECRVISEFVIPSV
YWVEDQNKKNELIEAFKQGMGKKACKYFEQGKGTCPFGSKCLYRHAYPDGRLAEPEKPRK
QLSSEGTVRFFNSVRLWDFIENRESQHVPSTDDVDVTELGDLFMHLSGVESSEP
Download sequence
Identical sequences ENSOPRP00000003203 ENSOPRP00000003203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]