SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003600 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003600
Domain Number 1 Region: 765-963
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.45e-47
Family DBL homology domain (DH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 1027-1224
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.49e-42
Family BAR domain 0.0025
Further Details:      
 
Domain Number 3 Region: 1519-1579
Classification Level Classification E-value
Superfamily SH3-domain 1.05e-17
Family SH3-domain 0.0000299
Further Details:      
 
Domain Number 4 Region: 244-312
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-17
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1292-1369
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.00000712
Further Details:      
 
Domain Number 6 Region: 143-204
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000184
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 7 Region: 4-62
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000084
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 8 Region: 69-133
Classification Level Classification E-value
Superfamily SH3-domain 0.00000158
Family SH3-domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003600   Gene: ENSOPRG00000003902   Transcript: ENSOPRT00000003913
Sequence length 1582
Comment pep:novel genescaffold:pika:GeneScaffold_105:136976:223204:-1 gene:ENSOPRG00000003902 transcript:ENSOPRT00000003913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGSVVRAIFDFCPSVSEELPLFVGDVIEVLAVVDEFWLLGKKEDVTGQFPSSFVEIVT
IPSLKEGERLLVCISEFTSQELNSLPLHRXXXXXXXXXLTAGWLQGRSCWGARGFFPSSC
VRELYLSSQSQRWHSQSALLQIPDYSMGQARALMGLSAQLDEELDFREGDVITIIGVPEP
GWFEGELEGRRGIFPEGFVELLGPLRTVDESVSSGEQDDCIVNGDVETPVGEAESELGDT
DEKPGAYGIALYRFQALEPNELDFDVGDKIRILATLEDGWLEGSLRGRTGIFPYRFVKLC
PDQRVEETPPQEGDHPEIIEPPLEDLENGLAVEEAQRASEVVSETSPSAHHHHLTSECAV
NQHAQHGEGASGGPPRGPGGPAKPPDRDSSTSGHTGVVNGLSSQPQAPFHTKLQRSQCYT
TAGGGPRGSARCPDLPSAARTRDYASLPPRGTGSQPRTLPTPLPALQRGSSLPACRGVRP
NSWSPQPQGPAPCAKKYQVCKENATGLGYAPEQPELKPGPQAWPTLEVPATPQAEGSLDL
DSKLTQQLIEFEKSLAGPGTGPDRAFRHFSIMDFNSEKDIVRGCPKPASLQELPERRRAL
RPPPPRPCVPAPASPRLFTDQSQTLTPPLAMRPSRPAPLPPSAQQRMSTVSPKLGAGPHP
RCDTPEEEHPEHMQGSPNHTSPHPFVLVRIQEVERDLDVYSRAQEELTLMLEEKQDESLR
AETLENLEFYESNIESLTVELQQLREMTLLSSQSSLAAPAATVSTENPEQRMLEKRAKVV
EELLQTERDYIRDLEMCIEHIMVPLQQAQLRYIEYEGLFGNMQVVIKVSKQLLAALETSD
AVGPVFLDQRDDLEGTYKVYCQNHDEAISLLEIYEKDEKIQKHLQDALADLKSLYNEWGC
TNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTSAVLVVKEINVNINEYKR
RKDLGEESVVVEKEYIQAQKVPFLTHSPVLKYRKGDEDSLMEKISKLNIHSIIKKSNRVS
SHLKHLTGFAPQIKDEAFEETEKNFRMQERLIKSFIRDLSLYLQHIRESACVKVVAAVSM
WDVCVERGHRDLEQFEKVHRYISDQLFTSFKERTERLVISPLTQLLSMFTGPHKLVQKRF
DKLLDFYNCTERAEKLKDKKTLEELQSARNNYEALNAQLLDELPRFQRCAQGLFAHCVHG
YAEAHRDFVQQALEQLQPLLSLLKAAGREGNLIAIFHEEHSRVLQQLQVFTFFPEALPAA
RKPFERKTTDRQSARKPLLGMPGYVLQSEELRASLLARYPPEKLFQAERNFNAAQELDVS
LLEGDLVGVVKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSDASVGSHSSTES
EHSGASPRFPRQNSGSTLTFNPSSMAVAFQKQPQDAGASKDCDSGTWSASLNLSSSEDGP
SEPTTSSPPRAGDSVDAARDTSQPTATLRSYRSSRPPEGVAYSVPGRNGQGRELPRGCAR
AAQPAEYQSKEPESIEAEGNQVYFAVYSFTARNPNELSVSANQRLKILEFRDVTGNTEWW
LAELNGKKGYVPSNYIRKTEYT
Download sequence
Identical sequences ENSOPRP00000003600 ENSOPRP00000003600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]