SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003702 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003702
Domain Number 1 Region: 244-338
Classification Level Classification E-value
Superfamily SEA domain 0.000000000114
Family SEA domain 0.0056
Further Details:      
 
Domain Number 2 Region: 921-1006
Classification Level Classification E-value
Superfamily SEA domain 0.000000458
Family SEA domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000003702
Domain Number - Region: 1056-1098
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1185-1236
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0562
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003702   Gene: ENSOPRG00000004002   Transcript: ENSOPRT00000004021
Sequence length 1240
Comment pep:novel genescaffold:pika:GeneScaffold_511:94169:190118:-1 gene:ENSOPRG00000004002 transcript:ENSOPRT00000004021 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPLFGKISLGILIFILIEGDLPSFTASAFVTSAEIQEPKSAISFLLSEESTEPSLPM
EKKQPLDRREAERRSLLRRQRAVLFPNGVKMCPDESVAETVANHVKYFKVRXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLTSAKETVSSSE
FSSPVPSDHTSTVGGAALRMSDPAVASHEVASESSLEKEKESISNEIEDVTDEPPKPATE
QVAEFSIHLLGKEYQKELQDPSSFHYQHLAEEFISEVENAFFGLPGYKDIRVLQFRSPKE
NDSGMDVHYAVTFNGEAISNTTWELISLHSNKVENHGLVELDDKPTAVYTISNFRDYIAE
TLHQNFLLGNSSLDPDPDSLQLISVRGVLLPQPEDPILNRQSPSLQAPSPTLDNTFQAEW
PSADGSTASSISPLDISSGPPSSTGRELSSESPLGDLVSTLDLAFPSKVGLGPSQEALEV
SGLTLHSVTPAVLPTDVPVAAEEGTSGSHLVEDXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKNPLEYKASEPRFLELLVPYLQSNLTGFQNLEILNFRNGSIVV
NSRMKFAESVPPNVNNAVYLILEDFCTTAYQTMNLAIDKYSLDVESGDDANPCKFQACNE
FSECLVSPWSGEAQCKCYPGYLSVDDLPCQSLCDLQPDFCLNDGKCDIMPGHGAICRCRV
GENWWYRGEHCEEFVSEPLVIGITIASMVGLLLVSSAAIFFLVKTLQVHSIRGEGERQFS
GSARQPDSLSFVENAVKCNPVFEGHEAGCELYEAAGLQHPFYSSASEEVLGGLSREEIRQ
MYESSGLSQEEIQERMRVLELYANDPEFAAFVREHQMEEL
Download sequence
Identical sequences ENSOPRP00000003702 ENSOPRP00000003702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]