SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003885 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003885
Domain Number 1 Region: 35-125
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-24
Family C-type lectin domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003885   Gene: ENSOPRG00000004232   Transcript: ENSOPRT00000004214
Sequence length 126
Comment pep:novel scaffold:pika:scaffold_10585:2971:13247:-1 gene:ENSOPRG00000004232 transcript:ENSOPRT00000004214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTCGLWGHGCKQWISMLKQNWCKCGLVCIVITIVATVCLKHSKTTACPSDLIGVGEKCF
YFSNDTGDWEASKRFCQSQGSELARVDTQTDMEFLKKHTGTAMHWIGLSRRLGESWKWTD
SSTFTD
Download sequence
Identical sequences ENSOPRP00000003885 ENSOPRP00000003885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]