SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000003889 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000003889
Domain Number 1 Region: 453-665
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.98e-42
Family Biotin holoenzyme synthetase 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000003889   Gene: ENSOPRG00000004228   Transcript: ENSOPRT00000004219
Sequence length 724
Comment pep:novel genescaffold:pika:GeneScaffold_3296:137295:290224:-1 gene:ENSOPRG00000004228 transcript:ENSOPRT00000004219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDRLQMDDGLVPQKIVSVHLRDSTLKQLKDHTFSEEAQPLQPSPEPSPEMEPTQGVTEP
VGNEDSRAPAQRRNSAPRSEPASGESEAVGGCTDHCHLHLSSCHECLELESSTIESIKFA
SSEDIPDLPYDASSSAEGSTAEPSTARAGRKVNVTGKAPNILLYVGSDSQEALSRLQQVR
CVLAECVDPDSYTLYHLLEESARRDPWLDNCVLLVVATQEAIPQDLSQKFLAYLSQGGKV
LGLCSTFTLDGLEVTNKGTPRGTVQKLVFSKADGSQVRLSVLSSGHVYEDRAEERLSPGL
LRGHLQDADEDRLIVQVPYGACGGEAVLCQVHLELPPSSSLVQTPEDFNVLKSSNSSRYE
VLLEILMTLGLSCDRKQAPALTPVYLLPTTQEIRDPLMKWLERQVDPDGVIKSSKVSLKF
VSSCAPDMEISPSSIPVVTDVETFSSEHFDLEVYREHLQTRQLGRTVLFAEVTPTTMSLL
DGLMFEMPQEMGLIAIAARQTQGRGRGQNAWLSPVGCALCTLLLSIPLRSLLGQRIPFVQ
HLMSLAVVEAVRTIPEYQDINLRVKWPNDIYYSDLMKIGGVLVNSVLLGEMFYILIGCGF
NVTNSNPTICINDLVAEYNRQHQAALKPLRADVLIARALTALETLVDTFQAQGPSSVLPV
YYKYWVHSGQQVRLGSAEGPEVSIVGLDDSGFLQVLREDGEVVSVHPDGNSFDMLRNLLV
PKGQ
Download sequence
Identical sequences ENSOPRP00000003889 ENSOPRP00000003889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]