SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004075 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004075
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 3.25e-17
Family Tetratricopeptide repeat (TPR) 0.0054
Further Details:      
 
Domain Number 2 Region: 844-883
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000952
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 766-799
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000518
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004075
Domain Number - Region: 902-930
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00011
Family CCCH zinc finger 0.0035
Further Details:      
 
Domain Number - Region: 627-658
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0108
Family CCCH zinc finger 0.0077
Further Details:      
 
Domain Number - Region: 502-530
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0589
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004075   Gene: ENSOPRG00000004406   Transcript: ENSOPRT00000004420
Sequence length 969
Comment pep:novel genescaffold:pika:GeneScaffold_4614:67535:95517:-1 gene:ENSOPRG00000004406 transcript:ENSOPRT00000004420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLHALVRNLFNEGNDVYRERDWK
SSISQYTEALNIADYAKSEDILIPKEIIEKLRINRIACYSNMGFHDQVLEDCDAVLSLNS
GNCKALYRKSKALSDLGRYREAYDAVAKCSLAVPKDEHVIKLTQELAQKLGFKIRKAYVR
AEDSLKSVPGDEATTVNYSVEDIEPDLSTPRQEEVPCVSLPASSFSHEVGSELASVPIVP
LASLLPLQVEESALPSAALANGGKVPFLGQEVILDDGDILGEEIDDLLDSAPEASESVTS
PPLLRGTLATTSVGPSLPFSASLLGTLPIGASYAPPPSFSELYPPLTSSLEDCCSSLNSF
SVGESKRDLSTSTSREGTTLNNSNSSFLFMNAPGIFYAPESFLGISTQPRNDFGNFFGSA
ITKPSSSVTPKHPLEGSHDLRPACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIKNV
EDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKGAFS
REAFFGGNGKVNLTVFKLLQEHLGEFMFLCEKCFDHKPRMISKINKDNSTSCSHPVTKHE
FEDNKCLVHILRETTVKYSKIRSFHSQCQLDLCRHEVRYGCLREDECFYAHSLVELKVWI
MQSETGISHDAIAQESKRYWQNLEANVPEAQVLGTQGMPGSLNMKIKFVCAECLRNGQVT
EPDKNRKYCSAKARHSWTKDRRAMRVMSIETKKWRNIRPLPTKKQMPVQFDLCNHIASGR
KCQYVGNCSFAHSPEERKVWTYMRENGIQDMEQFYELWLKSQKNEKSDDVTSQTNKENGK
QIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTG
YFSICERYMNGTCTEGTNCKFAHGNAELHEWEERRKALKMKLNKARKDHLIAPSDNDFGK
YSFLFKDLN
Download sequence
Identical sequences ENSOPRP00000004075 ENSOPRP00000004075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]