SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004243 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004243
Domain Number 1 Region: 506-570,612-710
Classification Level Classification E-value
Superfamily PH domain-like 7.87e-32
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 2 Region: 1130-1262
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-19
Family Second domain of FERM 0.0061
Further Details:      
 
Domain Number 3 Region: 715-843
Classification Level Classification E-value
Superfamily PH domain-like 4.56e-16
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000004243
Domain Number - Region: 1032-1108
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000351
Family UBX domain 0.062
Further Details:      
 
Domain Number - Region: 1266-1324
Classification Level Classification E-value
Superfamily PH domain-like 0.00553
Family Third domain of FERM 0.08
Further Details:      
 
Domain Number - Region: 140-175,617-637
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0701
Family BAR domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004243   Gene: ENSOPRG00000004566   Transcript: ENSOPRT00000004607
Sequence length 1401
Comment pep:novel genescaffold:pika:GeneScaffold_390:367522:419599:1 gene:ENSOPRG00000004566 transcript:ENSOPRT00000004607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAQGQRRRLRWRARGAREPCARRGPRARGRPPRNLEVVSIMAELKVETRASVDWQKRCLA
LETQLFRFRLQASKIRELLADKXXXXXXXXXXXXXXXXXXXXXMGVMEEKVKLSNMKNLE
ATGSLPRKYQELLQVLQCKDELIRRLEAQLEAQKQMRAEEAKTVQEAAKIKEWVTLKLAE
LEMENQQLKSCNQPLAEQVGALQDALAALRMTPSGKLLVSSQETPEKECAPSGPGAQPVP
QDSGSQAQGFKASVPAASPGAVQSKDLVCEAQSPLEDSSSSVTPCGKTAEAQLLQPHLGR
EGSPSRLGVKPHAPRYGSAPWGEGLVPAQGGMLSVTKTYVKAGGPGSSLTLPKARAPSTP
RDSIQLAKHHSQPQVPGHLDQVVSNEIGTLSVLYPAGLPKLKAAAQILEEPEKMEMEEPP
AARKKEDRESPKASGAGQEEAELWCKPPTPPLHRFPSWESRIYAVATSGMRLSDASSRSS
AACCASSPPALASPGPFSGLVYKNVTVPVYTALKGRATQISNVPFVDESSGSDDDCSSQA
SFRTSVPCSESRKASGLGSPRAIKRGVSVSSLSSEGDYAIPPDACSLDSDYSEPEHKLQR
TSSYSPDGLGPGAESLEKSGYLLKMGSRVKTWKRRWFVLRQGQIMYYKSPSDVIRKPQGQ
VDLNSHCQIIRGEGSQTFQLISEKKTYYLTADSPSLLEEWIRVLQSLLKVQATGPPAMPQ
GGTKPTVKGWLTKVKNGNSKLVWLALGGKTFQEYSTHKNKRPLGRLPVRDARIEEVDRSC
DSDEDYEAGGTGRLLSSHCTLVIHPPEHSPTYLLIGTKHEKDTWLYHLTVAAGGSSAKVG
TAYEQLIGKLMDGEGDPDSPLWKHPTLCYTRHGLAASLTTLPSEALQTEALKLFKSCQLF
INVPVEAASVDYHVSLAQTALQVCLVHPELQSEIYCQLMKQTSCRPPQKYSLVQCWQLLA
LCAPLFLPQHHFLWYVKQQLQRHADPRSETGQYATYCQRAVERTLQAGEREARPSRMEVV
SILLRNPFHHSLPFSIPVHLANGTYQVVGFDGSSTVDEILQRLNQETGMRRSSHSGFALF
TDDPSGRDLEHCLQGSIKICDAISKWEQALKELHPVKTEGGTRVVKLMYKNRLYFRSQVK
GETERERLLLACQASGEIVAGRFPVNKELALEMAALMAQVEYGDLEKPVLPGPGGTPPAK
AQHLLQQVLDRFYPRRYRHGAPPEQLRHLADTLSTKWAALQGCSPPECIRIYLTVARKWP
FFGAKLFAAQPAQLSSKESPFVWLAVNEDGVSILDHNTMQVHTTYPYATVTTFGGCKDDF
MLVIRPIPDQSSGKGHVEKLIFRMAAPKIAEATLIMASYMNHHATTVTPPTQLPVDPQPW
ELDGRQLFASVPGATKGPTLL
Download sequence
Identical sequences ENSOPRP00000004243 ENSOPRP00000004243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]