SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000004732 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000004732
Domain Number 1 Region: 310-602,707-750
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.39e-66
Family FAD-linked reductases, N-terminal domain 0.00051
Further Details:      
 
Domain Number 2 Region: 583-697
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.35e-23
Family L-aminoacid/polyamine oxidase 0.00037
Further Details:      
 
Domain Number 3 Region: 200-306
Classification Level Classification E-value
Superfamily Homeodomain-like 5.47e-20
Family SWIRM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000004732   Gene: ENSOPRG00000005129   Transcript: ENSOPRT00000005149
Sequence length 751
Comment pep:novel genescaffold:pika:GeneScaffold_3643:182:132905:1 gene:ENSOPRG00000005129 transcript:ENSOPRT00000005149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CAKNGYTSRWYHLSCGEHFCNECFDHYYRSHKDGYEKYIMWKKIWTSNGKTEPSPKAFMA
DQQLPYWVQCTKPECRKWRQLTKETQLTPQIAKAYRCGMKPNNAVKPEVSDHCSLPEDLX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXPGMNQYFQPFYQPNECGKALCVRPDVMELDELYEFPEYSRDPTMYLALRN
LILALWYTNCKEALTPQKCIPHIIVRGLVRIRCVQEVERILYFMTRKGLINTGVLSVGAD
QCLLPKDYHSKSVIVIGAGPAGLAAARQLHNFGIKVTVLEAKDRIGGRVWDDKSLKGVTV
GRGAQIVNGCVNNPVALMCEQLGISMHKFGERCDLIQEGGRITDPTIDKRMDFHFNALLD
VVSEWRKDKTQLQDVPLGEKIEEIYKAFKQESGIQFSELEEQVLQFHLSNLEYACGSNLH
QVSARSWDHNEFFAQFDGDHTLLTPGYSVIIKLAEGLDIRLKSPQVQSIDYTGEEVQVTT
TEGAGFSAQKVLVAVPLAMLQKGAIQFNPPLSEKKMKAISSLGAGIIEKIALQFPYRFWD
SKVQGADFFGHVPPSASQRGLFAVFYDMDPQKQQSVLMSVITGEAVASLRTLEDKQVLQQ
CMVTLRELFKEQEVPDPIKYFVTRWSTEPWIQMAYSFVKTCGSGEAYDIIAEEIQGTIFF
AGEATNRHFPQTVTGAYLSGVREASKIAAFI
Download sequence
Identical sequences ENSOPRP00000004732 ENSOPRP00000004732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]