SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005176 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005176
Domain Number 1 Region: 128-270
Classification Level Classification E-value
Superfamily Cadherin-like 7.07e-27
Family Cadherin 0.0000701
Further Details:      
 
Domain Number 2 Region: 361-487
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-26
Family Cadherin 0.0005
Further Details:      
 
Domain Number 3 Region: 252-368
Classification Level Classification E-value
Superfamily Cadherin-like 4.32e-18
Family Cadherin 0.00035
Further Details:      
 
Domain Number 4 Region: 41-140
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000537
Family Cadherin 0.0017
Further Details:      
 
Domain Number 5 Region: 484-578
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000537
Family Cadherin 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000005176
Domain Number - Region: 19-52
Classification Level Classification E-value
Superfamily Cadherin-like 0.0502
Family Cadherin 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005176   Gene: ENSOPRG00000005644   Transcript: ENSOPRT00000005639
Sequence length 608
Comment pep:novel scaffold:pika:scaffold_105:95846:607498:1 gene:ENSOPRG00000005644 transcript:ENSOPRT00000005639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVIVGGKDIQASLQDIFKYARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDS
DRPEGSKFRLTGKGVDQEPKGIFRINENTGSVSVTRTLDREAIATYQLSVETTDINGKTL
EGPVPLEVIVIDQNDNRPIFREGPYVGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYH
IRQQTPDKPSPNMFYIDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTG
TATATVMIDDKNDHSPKFTKKEFQATVEEGAVGVIVNLTVEDKDDPATGAWRAAYTIING
NPGQSFEVHTNPQTNEGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVH
ITVLDVNEGPVFFPDPMTVTRREDISVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLN
INPSNGTVDTTAVLDRESPFVHNSVYTALFLAVDSGSPPATGTGTLLVTLEDVNDNAPVL
HPTVAEVCDDAKNLSVVILGASDKDLHPNTDPFKFEIHKQTVPDKVWKISKINNTHALVS
LLQNLNKANYNLPIMVTDSGTPPMTNITDLRVQVCSCKNSKVDCNSTGALRASLALALLV
TLFSIACL
Download sequence
Identical sequences ENSOPRP00000005176 ENSOPRP00000005176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]