SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005521 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005521
Domain Number 1 Region: 264-531
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.45e-62
Family Protein kinases, catalytic subunit 0.00000000296
Further Details:      
 
Domain Number 2 Region: 124-252
Classification Level Classification E-value
Superfamily SH2 domain 1.67e-38
Family SH2 domain 0.00000682
Further Details:      
 
Domain Number 3 Region: 76-145
Classification Level Classification E-value
Superfamily SH3-domain 3.49e-19
Family SH3-domain 0.0000809
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005521   Gene: ENSOPRG00000006004   Transcript: ENSOPRT00000006012
Sequence length 539
Comment pep:novel genescaffold:pika:GeneScaffold_4292:197154:223583:-1 gene:ENSOPRG00000006004 transcript:ENSOPRT00000006012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKENKSPAIKYRTENTPEPVSTSASHYGVDLSPGAPRPPGASADFSNLSITPFGG
SSGVTPFGGASSSFSVVPSSYPAGITGGVTIFVALYDYEARTTEDLSFKKGERFQIINNT
EGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIFLV
RESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHA
DGLCHKLATGCPAVEPQTQGLAKDRCEIPRDSLRLEVKLGQGCFGEVWMGTWDETTKVAI
KTLKPGTIVPEAFLQEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLLDFLKEGD
GKYLKLPQLVDMAAQIAGGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIEDN
EYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVLEQ
VERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences ENSOPRP00000005521 ENSOPRP00000005521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]