SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005660 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005660
Domain Number 1 Region: 853-934
Classification Level Classification E-value
Superfamily DEATH domain 8.95e-22
Family DEATH domain, DD 0.00000934
Further Details:      
 
Domain Number 2 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000183
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 3 Region: 155-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000038
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 298-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.0006
Further Details:      
 
Domain Number 5 Region: 48-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000366
Family I set domains 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005660   Gene: ENSOPRG00000006165   Transcript: ENSOPRT00000006172
Sequence length 943
Comment pep:novel genescaffold:pika:GeneScaffold_1086:3916:74846:1 gene:ENSOPRG00000006165 transcript:ENSOPRT00000006172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAWSGARGALLLALLLCWDPRLSRAGTDSGSEVLPDSFPSAPAEPLPHFLQEPQDAYIV
KNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGVDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSSGTTKSHRAYVRIAYLRKNFDQEPLGKEVPLDHQVLLQCRPPEGV
PVAEVEWLKNEDIIDPSQDTNFLITIEHNLIIRQARLLDTANYTCVAKNIVAKRRSTTAT
IIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVHNKKTL
SDPKSHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRD
GSSVSGFGCLGGRISIPGTGVSLLVPNGAIPQGKFYEMYLLINTAESTLPLSEGTQTVLS
PSVTCGPTGLLLCRPVILTIPHCAEVGAGDWIFQLKTQAHQGHWEEVVTLDEETLNTPCY
CQLEARSCHILLDQLGTYVFTGESYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDMPV
ALKEVLELERTLGGYLVEEPKPLLFKDSYHNLRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPAGSLDALCSA
PGSAVTTQLGPYAFKIPLSIRQKICNSLDAPNARGNDWRLLAQKLSMDRYLNYFATKASP
TGVILDLWEALQQDDGDLNTLASALEEMGKSEMLVAMATDGDC
Download sequence
Identical sequences ENSOPRP00000005660 ENSOPRP00000005660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]