SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000005886 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000005886
Domain Number 1 Region: 523-553,656-735
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000188
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000005886   Gene: ENSOPRG00000006404   Transcript: ENSOPRT00000006421
Sequence length 874
Comment pep:novel genescaffold:pika:GeneScaffold_1444:307535:327909:-1 gene:ENSOPRG00000006404 transcript:ENSOPRT00000006421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYVVDRAAYSVTLLDEEFEKKERTYPVGEKLRNACRCSPAKFKSLLFGLLPVLS
WLPKYKIKDYIIPDVLGGLSGGCIQVPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLT
AVIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYVFGLTIPSYSGPGSIVFT
FIDICKKLPDTNIASLVFALVSGVVLVVVKELNARYMHKIHFPIPTEMIVVVVATAISAS
FKMPQKYNMPIVGEIRQGFPSPVSPVVSQWKDMIGTAFSLAIVSYVINLAMGRTLANKHG
YDVDPNQEMIALGCSNFFGSFFKIHVICCALSVTLAVDAAGGKSQISSLCVSLVVMVTML
VLGSYLYSLPKSVLGALISVNLKNSLKQLTDPYYLWKKNKLDCCVWVVSFLSSFFLSLPY
GVAVGVAFSVLVVVFQTQFRNGHALGQIMDTDIYVNPKAYSRVQEIEGIKIVTYCSPLYF
ANSEIFRQKVISKTGTDPQKILLAKQKYLRKQEKRKRVPTQQRKSLFMKTKTVSLQELQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPEELSDTLAGVPFIT
FHTLILDLSGVSFVDLMGIKALAKLGSTYEKIGVKVFLVNIHAQVYNDLSHGGVFDDGCL
KRHHIFPSTHDAVLFAQADAREATPGPSFQGVPGDTEHSFCDSEEESPRYWDLEQEMFGS
MFHAETLTALGRSAAGVCPYRQESLALTTLNGPPTPATPPAALSVAAVRHPGFWTSRGSQ
EQKDKLSRADHLYKLHKGHLLDLVSGGVRPSQDQ
Download sequence
Identical sequences ENSOPRP00000005886 ENSOPRP00000005886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]