SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006060 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006060
Domain Number 1 Region: 199-221
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000017
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006060   Gene: ENSOPRG00000006615   Transcript: ENSOPRT00000006616
Sequence length 911
Comment pep:novel genescaffold:pika:GeneScaffold_3275:82:30336:1 gene:ENSOPRG00000006615 transcript:ENSOPRT00000006616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVAESPERGARSPEGDEEQQGLSDDDILRGSGSDQDADGAGEDEERAAGAPGPEEDPSD
EEDGASEAKSQDQDSEGNALSRGPAHSPCEGEGEDGEEERTSDLRDEASSVTRELDEHEL
DYDEEVPEEPEKESERAAAEEEEEGKVGAPEAAGPEPPEAGADKRKGQDDGEIDDGEIED
DDLEEGEVKDPSDRKVRPRPTCRFFMKGNCTWGVNCRFIHPGVNDKGNYSLLTKAEPFPP
NGAPPLGPHPLMPANPWGGPAVEEILPPPPPEPPTESAWERGLRHAKEVLKKATIRKEQE
PDFEEKRFTVTIGEDEREFDKENEVFRDWNARMPRDVRDPAMEPYADPYYDYEVERFWRG
GQYENFRVQYTEAEPYHSYRERERDRERENRQRERERERERERRQRERERERERDKERQR
RKEEWERERAKRDEKDRRDRDKERERPKPRSPQPPSRPAEPPRKEAAAPGPQVKRADEWK
DPWRRSKSPKKKLGVSVSPSRARRRRKTSASSASASNSSRSSSRSSSYSGSGSSRSRSRS
SSYSSYSSRSSRHSSFSGSRSRSRSFSSSPSPSPTPSPHRPSVRAKGEPALPPGRAGEKS
VKKPASAPAAPQATKTTALAPEPSKGDPREVRRKERQARTPPRRRTLSGSGSGSSYSGSS
SRSRSLSVSSVSSVSSATSSSSSVHSVDSEDMYADLASPVSSASSRSPTPAQTKKEKGKS
KREDAAKEDKRKKDSTQPAKSTRAPAGGKASQASTAPQQAAPGQCAQGAFVAHKEIKLTL
LNKAADRGSRKRYEPSDKERQSPPAKRANLSPERGARDRKSGGRPGSPKAERQRGQNARA
PAAPADRKRQLSPQSKSSSKVTSVPGRASEAGAGSKSGKASTLSRREELLKQLKAVEDAI
ARKRAKIPGKV
Download sequence
Identical sequences ENSOPRP00000006060 ENSOPRP00000006060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]