SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006270 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006270
Domain Number 1 Region: 1-175
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-68
Family Ephrin receptor ligand binding domain 0.00000202
Further Details:      
 
Domain Number 2 Region: 683-822
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.76e-35
Family Protein kinases, catalytic subunit 0.0000102
Further Details:      
 
Domain Number 3 Region: 898-970
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.09e-16
Family SAM (sterile alpha motif) domain 0.00092
Further Details:      
 
Domain Number 4 Region: 432-520
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000238
Family Fibronectin type III 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006270   Gene: ENSOPRG00000006841   Transcript: ENSOPRT00000006845
Sequence length 974
Comment pep:novel genescaffold:pika:GeneScaffold_2146:56148:177455:-1 gene:ENSOPRG00000006841 transcript:ENSOPRT00000006845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVLLDSKASQAELGWTALPSNGWEEISGVDEHDRPIRTYQVCNVLEPSQDNWLQTGWIS
RGRGQRIFVELQFTLRDCSSIPGAAGTCKETFNVYYVETEADLGRGRPRLGGSRPRKIDT
IAADESFTQGDLGERKMKLNTEVREIGPLSRRGFHLAFQDVGACVALVSVRVYYKQCRAT
VRGLAAFPATAAESAFSTLVEVTGTCVAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAG
FQERGDICEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXEPQSVSLSWREPIPAGGPGANNTEYEIRYYEKGQSEQAYSTVKTGAPAV
TVTNLKPATRYVFQIRAASPGPSWEDQSFNPSIEVQTPGEVASEPRDQSPAVVVTVVTIS
ALLVLGSVMSVLAIWRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXSPLMIVTEYMSHGALDDFLRQHEGQLAAGQLLGFLPGL
ASAMKYLSEMGYVHRGLAARRVLVSPGLVCKISGFGRGPRDRAEAVYTTMSGRSPALWAA
PETLQFGHFSSASDVWSFGVVMWEVMAFGERPYWDMSGQDXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPTPLADRAFSTFPS
FCSVGAWLEALDLCRYKDSFAAAGYGTLEAVAEMTAQDLTSLGISSAEHREALLSGIGAL
RARVLQLQGQGVQV
Download sequence
Identical sequences ENSOPRP00000006270 ENSOPRP00000006270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]