SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006589 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006589
Domain Number 1 Region: 1794-1815,1910-2040
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.68e-33
Family Ankyrin repeat 0.00000922
Further Details:      
 
Domain Number 2 Region: 886-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000592
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 3 Region: 757-892
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000345
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 1149-1282
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000643
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 235-282
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000037
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 732-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000754
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 7 Region: 923-966
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000951
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 8 Region: 273-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000438
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 9 Region: 120-162
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000678
Family EGF-type module 0.036
Further Details:      
 
Domain Number 10 Region: 157-194
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000821
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 11 Region: 40-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000015
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 615-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000393
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 13 Region: 197-239
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000042
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 14 Region: 1398-1430
Classification Level Classification E-value
Superfamily Notch domain 0.000000101
Family Notch domain 0.0015
Further Details:      
 
Domain Number 15 Region: 695-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 1279-1318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.015
Further Details:      
 
Domain Number 17 Region: 1350-1390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000116
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 18 Region: 657-699
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000205
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 19 Region: 1477-1508
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 20 Region: 83-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000725
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 507-535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000354
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 22 Region: 8-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000276
Family EGF-type module 0.019
Further Details:      
 
Domain Number 23 Region: 313-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000448
Family EGF-type module 0.015
Further Details:      
 
Domain Number 24 Region: 957-986
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000916
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000006589
Domain Number - Region: 1440-1471
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006589   Gene: ENSOPRG00000007177   Transcript: ENSOPRT00000007196
Sequence length 2446
Comment pep:novel genescaffold:pika:GeneScaffold_2131:10433:129950:-1 gene:ENSOPRG00000007177 transcript:ENSOPRT00000007196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQCRDGYEPCVNKGTCVTSPNGTGYCECPEGFLGEYCQHRDPCEKNRCQNGGTCVSQATL
GKATCRCAPGFTGEDCQFSTSHPCFVSRPCQNGGICHTRGRDTFECTCQVGFTGKLCQWT
DACLSHPCANGSTCTIVANQISCRCLAGFTGQRCETDVNECDVPGRCQHGGTCLNLPGSY
QCQCPQGFTGQHCESPYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGNTCERNIDDCP
NHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGDYGCV
CVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXVNCEINFDDCASSPCVHGVCVDGINRYNCVCSPGYTGQRCNIDIDE
CASNPCRKGATCVNDVDGFRCLCPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLC
DAGWVGVNCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGHNCQVNIDECASNPCL
NQGTCFDDISGYTCQCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPDFESYTCVCAPGW
QGQRCTIDVDECVSKPCLNHGVCHNTQGSYMCECPPGFSGMDCEEDIDDCLTNPCQNGGS
CMDRVNTFSCLCLPGFVGEKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCAGLEGVHCEH
NIDECTESSCFNGGTCIDGINSFSCLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXCVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENI
DDCAGGPHCFNGGQCVDRIGGYSCRCLPGFAGERCEGDINECLSSPCSSEGSLDCIQLTN
NYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVASNTPDGFICRCPPGFSGARCQSSC
GQVKCRRGEQCVHTASGPRCFCPNPQDCDSGCASSPCQHGGSCYPQRQPPYYSCRCAPPF
WGSHCELYTAPTSSPPATCLSQYCADKARDGVCDEACNSHACQWDGGDCSLTMEDPWANC
SSPLPCWDYINNQCDELCNTAECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNSEE
CGWDGLDCAADRPENLAEGMLVIVVLMPPEQLLQDSRSFLRALGTLLRTNLRIKQDSQGN
MMVYPYYGEKSAAMKKQRMARRSLPNEQEQEVVGSRVFLEIDNRQCVQDSDQCFKNTDAA
AALLASHAIQGTLSYPLVSVVSESLTPKGTQMLYLLAIAVVIILFIILLGVIMAKRKRKH
GSLWLPEGFTLRRDTSNHKRREPVGQDAVGLKNLSVQVSESNLIVSGTSGHWVDDEGPQP
KKAKAEDEALLSEEDDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVNVRGP
DGCTPLMLASLRGGSSDVSDEDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILIRNRVTDLDARMNDGTT
PLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRDMQ
DNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDEYN
VTPSPPGTMLTSALSPVICGPNRPFLSLKHTPMGKKPRRPNAKSAIPTSLPNLAKEAKEA
KGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSDTTSSPMITSPSILQASPNPMLAT
AAPTAQVHAQHALSFSNLHEMQPLAHGGANTVLPSVSQLLSHHHIVPPGNGSAGSLGRLH
PVTVPADWMNRVEVNETQYNEMFGMVLAPTEGTHPGITPQSRPPEGKHIAPPREPLPPIV
TFQLIPKGSIGQSTGTSQTQSSCAPAVAGPLPTMYQIPEMARLPGVAFPTAMMPQQEGQV
AQTILPAYHPFPASVGKYPTPPSQHSYASSSAAERTPSHSGHLQGEHPYLTPSPESPDQW
SSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMSEPPHNNMQVYA
Download sequence
Identical sequences ENSOPRP00000006589 ENSOPRP00000006589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]