SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000006677 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000006677
Domain Number 1 Region: 269-384
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-28
Family SH2 domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000779
Family Phosphotyrosine-binding domain (PTB) 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000006677   Gene: ENSOPRG00000007295   Transcript: ENSOPRT00000007290
Sequence length 396
Comment pep:novel genescaffold:pika:GeneScaffold_990:521:11372:-1 gene:ENSOPRG00000007295 transcript:ENSOPRT00000007290 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAINRLHEAVPGVRGSWKKKAPNKALASILGTSNLRFAGMTISVHISVEGLSLSVPATRQ
TIASHHMQSISFASGGDTDMTDYVAYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPGDGYVQADAQGPRDYEEHLYVNTQGL
DAADAGPEQLEDSPKKDLFDMRPFEEALKTHPCALADRWPSPPTRRAPVAPTEEQLRQEP
WYHGRMTRRAAERLLRADGDFLVRDSATNPGQYVLTGMQAGQPKHLLLVDPEGVVRTKDV
LFESISHLIDYHLQNGQPIVAAESELHLRGVVTREP
Download sequence
Identical sequences ENSOPRP00000006677 ENSOPRP00000006677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]