SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008062 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008062
Domain Number 1 Region: 1351-1578
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-38
Family Laminin G-like module 0.0032
Further Details:      
 
Domain Number 2 Region: 396-508
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-31
Family Cadherin 0.00084
Further Details:      
 
Domain Number 3 Region: 811-917
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-28
Family Cadherin 0.00063
Further Details:      
 
Domain Number 4 Region: 501-606
Classification Level Classification E-value
Superfamily Cadherin-like 1.06e-27
Family Cadherin 0.0011
Further Details:      
 
Domain Number 5 Region: 286-394
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 181-284
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 912-1026
Classification Level Classification E-value
Superfamily Cadherin-like 1.37e-25
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 703-807
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 9 Region: 606-707
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 10 Region: 1601-1704
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.34e-17
Family Laminin G-like module 0.032
Further Details:      
 
Domain Number 11 Region: 1020-1122
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000157
Family Cadherin 0.0079
Further Details:      
 
Domain Number 12 Region: 1278-1368,1565-1614
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000298
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1927-1967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 14 Region: 1832-1879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000089
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000008062
Domain Number - Region: 2435-2638
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0183
Family Rhodopsin-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008062   Gene: ENSOPRG00000008762   Transcript: ENSOPRT00000008809
Sequence length 2922
Comment pep:novel genescaffold:pika:GeneScaffold_4424:194088:220198:1 gene:ENSOPRG00000008762 transcript:ENSOPRT00000008809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRAACVSLSTSLPPLLLLLLLLVLLLPLPLLGDQVGPCRSLGTGGRGSPGSCKPVGWL
CPASASNLWLYTSRCRDEGTELTGHLVPHHDGLRVWCPESGTHIPLPPAPAGCPWSCRLL
GIGGHLSPQGKLTLPEQHPCLKAPRLRCLSCQLAQGPGLRTGQGLPEGSPGGRRKRNVNT
APQFQPPSYQATVPENQPAGTSVAALRAIDPDEGEAGRLEYTMDALFDSRSNHFFSLDPI
TGAVTTAEELDRETKSTHVFRVTAQDHGVPRRSALATLTILVTDTNDHDPVFEQQEYKES
LRENLEVGYEVLTVRATDGDAPANANILYRLLEGPGGHPSEVFEIDPRSGVIRTRGPVDR
EEVESYQLTVEASDQGREPGPRSATAAVFLSVEDDNDNAPQFSEKRYVVQVREDVTPGAP
VLRVTASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRVRAQ
DGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDN
ARLEYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGSPVLTASASVS
VTVLDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFS
ITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQSSHY
TVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYED
QVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQV
SATDRDSGLNGRVFYTFQGGNDGDGDFIVESTSGIVRTLRRLDRENVAQYVLRAYAVDKG
MPPARTPVEVTVAVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIM
YQIVEGNIPEVFQLDIFSGELTALVDLDYEDRPEYVLVIQATSAPLVSRATVHVRLLDRN
DNPPVLGNFEILFNNYVTSRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNA
STGELRLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLEDMS
PERFLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGRILNVSLSVGQPPGPAGGP
PFLPSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIA
SSSVLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLCRDG
YTGEHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCRVTTRSFPARSF
VTFRGLRQRFHFTLALSFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTT
TVSPFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALRFGA
VLGNYSCAAQGTQSGSKKSLDLTGPLLLGGVPDLPENFPVRMRHFVGCMRNLQVDSRHVD
MADFIANNGTVPGCSAKKNVCDSNTCHNGGTCVNQWDAFSCECPLGFGGKSCAQEMANPQ
HFLGNSLVAWHGLSLPISQPWHLSLMFRTRQANGVLLQAVTRGRSTITLQLQEGHVLLSI
EGTGLQASSLLLEPGRANDGDWHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXYYGDNCTNVCELNPCEHQSVCTRKPSAPHGYTCEC
PPNYLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPPG
SSTCLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCP
RAIEAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSELKGFX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXDLLRVGSALLDAANKRHWELIQQTEGAPAWLQHYEAYASALANMRHTLSPL
IVTPNIVISVVRLDKGNFAGAKLPRYEALRGERPPDLETTVILPESVFREVSPMVRPAGP
GEAQEPEEVARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPVINTP
VVSISVHDDEELLPRSLDKPVTVQFRLLETEERTXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXALAQLVLLLGVNQADLPFACTVIAILLHFLYLCTFSWALLEA
LHLYRALTEVRDVNAGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYDTLIW
SFAGPVAFAVSMSVFLYILAARASCAAQRQGFEKKGPISGLQPSFAVLLLLSAAWLLALL
SVNSDTLLFHYLFAACNCLQGPFIFLSYVVLSKEVRKALRFACSRKPSPDPALTTKSTLT
SSYNCPSPYTDGHLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPGQGPPGLGD
PGGLFLEGQGQQHDADTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFLIFNFLH
Download sequence
Identical sequences ENSOPRP00000008062 ENSOPRP00000008062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]