SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000008445 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000008445
Domain Number 1 Region: 135-303
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.004
Further Details:      
 
Domain Number 2 Region: 75-129
Classification Level Classification E-value
Superfamily TGS-like 0.00000206
Family TGS domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000008445   Gene: ENSOPRG00000009228   Transcript: ENSOPRT00000009230
Sequence length 322
Comment pep:novel genescaffold:pika:GeneScaffold_3126:68055:98800:-1 gene:ENSOPRG00000009228 transcript:ENSOPRT00000009230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WEAMAAGVRALRFCRVFPGGGAGCRCIATSPAAQLSPLELTARRNELFNKEKRRQLSLTP
RTEKIEVKHVGKTDPGTVFVMNNISTPYSCAMHLSEWYCKKSILALVDGQPWDMYKPLTK
SCEIEFLTFKDRDPGEVNKAYWRSCAMMMGCVIERAFKDEFTVTLVRAPEVPVIAGAFCY
DVVLDERLDEWVPTKENLRSFTKDVHALIYKDLPFEALEVEAKVALEIFQHNKYKINFIE
EKSSQNAERKVKLHRIGDFIDVSEGPLIPRTSVCSQYEVSAVHSLQPTQPNHVRRFQGLS
LPVHLRAQFTIWDKLLERSRKL
Download sequence
Identical sequences ENSOPRP00000008445 ENSOPRP00000008445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]