SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009122 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009122
Domain Number 1 Region: 76-156,214-303
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.4e-32
Family G proteins 0.0024
Further Details:      
 
Domain Number 2 Region: 284-363
Classification Level Classification E-value
Superfamily TGS-like 6.87e-18
Family G domain-linked domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009122   Gene: ENSOPRG00000009987   Transcript: ENSOPRT00000009984
Sequence length 364
Comment pep:novel genescaffold:pika:GeneScaffold_1122:416:32632:1 gene:ENSOPRG00000009987 transcript:ENSOPRT00000009984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILEKISEIEKEIARTQKNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXSTFLSLMTSTASEAASYEFTTLTCIPGVIEYKGANIQLLDLPGII
EGAAQGKGRGRQVIAVARTADVVIMMLDATKGEVQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFNAEVLFREDCSPDEFIDVIVGNRVYMP
CLYVYNKIDQISMEEVDRLARKPNSVVISCGMKLNLDYLLEMLWEALALTCIYTKKRGQR
PDFSDAIILRKGASVEHVCHRIHRSLASQFKYALVWGTSTKYSPQRVGLSHTVEHEDVIQ
IVKK
Download sequence
Identical sequences ENSOPRP00000009122 ENSOPRP00000009122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]