SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009454 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009454
Domain Number 1 Region: 273-341
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000486
Family RING finger domain, C3HC4 0.026
Further Details:      
 
Domain Number 2 Region: 57-80
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000085
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number 3 Region: 208-233
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000377
Family CCCH zinc finger 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000009454
Domain Number - Region: 90-109
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000249
Family CCCH zinc finger 0.0063
Further Details:      
 
Domain Number - Region: 366-394
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00183
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009454   Gene: ENSOPRG00000010353   Transcript: ENSOPRT00000010349
Sequence length 485
Comment pep:novel genescaffold:pika:GeneScaffold_2089:108640:127935:-1 gene:ENSOPRG00000010353 transcript:ENSOPRT00000010349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAAPGTTATTSGAGAAAAVVAAASPTPIPTVTAPSPGAGGGGVGHEGGGGGWTKQVT
CRYFMHGVCKEGDNCRYSHDLSDSPYGIVSEYFQRGYCIYGDRCRYEHSKPLKQEDTTAT
DLAAKPSLAASSSLPSVVGPLAEMNTGETESRNSNFATVGAGSEDWVNAIEFVPGQPYCG
RTASSCTEAPPQGSVTQEESEKEQTAAETKKQLCPYAAVGECRYGENCVYLHGDSCDMCG
LQVLHPTDAAQRSQHIKSCIEAHEKDMELSFAVQRSKDLLCGICMEVVYEKANPSERRFG
ILSNCSHTYCLKCIRKWRSAKQFESKIIKSCPECRITSNFVIPSEYWVEEKEEKQKLIQK
YKEAMSNKACRYFDEGRGSCPFGGNCFYKHAYPDGRREEPQRQKVGTSSRYRXXXXXXXX
XXXXXXXXXXXXTPFDNDDEEVVTFELGEMLLMLLAAGGDDELTDSEDEWDLFHDELEDF
YDLDL
Download sequence
Identical sequences ENSOPRP00000009454 ENSOPRP00000009454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]