SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009635 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009635
Domain Number 1 Region: 1-104
Classification Level Classification E-value
Superfamily SRP19 1.18e-35
Family SRP19 0.00000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009635   Gene: ENSOPRG00000010549   Transcript: ENSOPRT00000010545
Sequence length 130
Comment pep:novel genescaffold:pika:GeneScaffold_1895:9979:17213:1 gene:ENSOPRG00000010549 transcript:ENSOPRT00000010545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FICIYPATLNNKKTIAEGRRIPVSKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNR
DVQYRGRVRVQLKQEDGSLCLGQFPSRKSVMLYAAEMIPKLKTRTQKAGGGDPSVQQGDG
GKKGRGKKKK
Download sequence
Identical sequences ENSOPRP00000009635 ENSOPRP00000009635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]