SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009717 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009717
Domain Number 1 Region: 99-230,326-517
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 9.15e-46
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.016
Further Details:      
 
Domain Number 2 Region: 619-739
Classification Level Classification E-value
Superfamily PKD domain 5.1e-18
Family PKD domain 0.00026
Further Details:      
 
Domain Number 3 Region: 753-821
Classification Level Classification E-value
Superfamily PKD domain 0.00000837
Family PKD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009717   Gene: ENSOPRG00000010625   Transcript: ENSOPRT00000010637
Sequence length 1046
Comment pep:novel genescaffold:pika:GeneScaffold_3185:6652:583047:1 gene:ENSOPRG00000010625 transcript:ENSOPRT00000010637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAEELRLPSTSFALTGDSAHSQAMVHWSGHNSSVILILTKLYDFNLGSVTESSLWXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXIMLLSDPELESSILISSDEGATYQKYRLTFY
IQSLLFHPKQEDWVLAYSLDQKLYSSMDFGRRWHLMHERITPNRFYWSVAGLDKEADLVH
MEVRTADGYAHYLTCRIQECAETTRSGPFVRSIDISSLVVQDEYIFIQVTTGGRASYYGA
YRREAFAQIKLPKYSLPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXVAGIKGIFLANKKVDDQVKTYITYNKGRDWRLLQAPDVDLRG
SPVHCLLPFCSLHLHLQLSENPYSSGRISSKQTAPGLVVATGNIGSELSYTDIGVFISSD
GGNTWRQIFDEEYNVWFLDWGGALVAMKHTPLPVRHLWVSFDEGHSWDKYAFTSVPLFVD
GALVEAGMETHIMTVFGHFSLRSEWQLVKVDYKSIFSRRCTKEDYQTWHLLNQGEPCVMG
ERKIFKKRKPGAQCALGRESSGSVVSEPCVCADWDFECDYGYERHGESQCVPAFWYNPAS
PSKDCSLGQSYLNSTGYRRIVSNNCTDGLRDKYTAKAQLCPGKAPRGLHVVTTDGRLVAE
QGHNATFIILMEEGDLQRTNIQLDFGDGIAVSYANFSPIEDGIKHVYKSAGIFQVTAYAE
NNLGSDTAVLFLHVVCPVEHVHLRVPFVAIRNKEVNISAIVWPSQLGTLTYFWWFGNSTK
PLITLDSSVSFTFLAEGTNTITVQVAAGNALIQDTKDIAVHEYFQSQLLSFSPNLDYHNP
DIPEWRQDIGNVIKKALIKVTSVPEDQILVAVFPGLPTSAELFILPPKNLTERRKGNEAD
LEQIVEILFNALNQNLVQFELKPGVQVIVYVTQLTLAPLVDSSAGHSSSAMLMLLSVVFV
GLAVFLIYKFKRKIPWINIYAQVQHDKEQEMIGSVSQNENAPKITLSDFTEPEELLDKEL
DTRIVGGIATIVNSESTKEIPNCTSV
Download sequence
Identical sequences ENSOPRP00000009717 ENSOPRP00000009717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]