SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000009728 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000009728
Domain Number 1 Region: 58-136
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000000237
Family Cold shock DNA-binding domain-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000009728   Gene: ENSOPRG00000010664   Transcript: ENSOPRT00000010651
Sequence length 154
Comment pep:novel scaffold:pika:scaffold_20366:11957:13347:1 gene:ENSOPRG00000010664 transcript:ENSOPRT00000010651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSEPTSPRVVPPLHFPKSPVCPTFPSNGKGSRVWERGSTSLRDLPSPLPTKRTRTYSA
TARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEGEYVPVEGDEVTYKMCP
IPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS
Download sequence
Identical sequences ENSOPRP00000009728 ENSOPRP00000009728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]