SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010014 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010014
Domain Number 1 Region: 185-308
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000332
Family SH2 domain 0.0034
Further Details:      
 
Domain Number 2 Region: 3-62
Classification Level Classification E-value
Superfamily PH domain-like 0.000000184
Family Phosphotyrosine-binding domain (PTB) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010014   Gene: ENSOPRG00000010961   Transcript: ENSOPRT00000010965
Sequence length 334
Comment pep:novel genescaffold:pika:GeneScaffold_3283:60558:63874:-1 gene:ENSOPRG00000010961 transcript:ENSOPRT00000010965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHALRHVLYSTWCPADCQIAFIVQSPRSPASKLFCHLFVGRQPGEIHILHLLLCRSFQL
AYLLQHPEERARPEPCQATTGDEPRKPAAGPPALVREPFGLDQLSQNVHALVSFRLPAEG
LVGSGKELSELEGGGTRHGRLGNPYCSPTLVHKKAICSKVIHCGAYRACTHEAQLQLLAR
EAFPAAWEAWPQGPGGSSCLLESKGSLTENIWAFAGISSPSALLLWRDMLGAFLLWPEPG
TSGQWCLSVLTQCSMVPYQVFRNRVGHYCLEPADFPSLEALVESHSGTECRLLCPLDMGH
LNPTYEEQDGPGRPPRTLWPLSHTKSEAELQSLG
Download sequence
Identical sequences ENSOPRP00000010014 ENSOPRP00000010014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]