SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010064 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010064
Domain Number 1 Region: 234-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-79
Family Protein kinases, catalytic subunit 0.00000000143
Further Details:      
 
Domain Number 2 Region: 124-267
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-37
Family SH2 domain 0.0000085
Further Details:      
 
Domain Number 3 Region: 96-133
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000119
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010064   Gene: ENSOPRG00000011016   Transcript: ENSOPRT00000011020
Sequence length 512
Comment pep:novel genescaffold:pika:GeneScaffold_3823:343864:401934:1 gene:ENSOPRG00000011016 transcript:ENSOPRT00000011020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKRKDNLNDDGVDLKTQPVRNTDRTIYVRDPTSNKQPRPVSESQLLPGQRFQTKX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGEWWKAKSLSTKREGFIPSNYVAK
VNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDYDPVNGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQSDGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTKEEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINYGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMSALSQGYRMPRMENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
Download sequence
Identical sequences ENSOPRP00000010064 ENSOPRP00000010064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]