SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010207 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010207
Domain Number 1 Region: 235-275
Classification Level Classification E-value
Superfamily CCCH zinc finger 3.79e-16
Family CCCH zinc finger 0.00091
Further Details:      
 
Domain Number 2 Region: 207-233
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000000235
Family CCCH zinc finger 0.0017
Further Details:      
 
Domain Number 3 Region: 180-204
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000863
Family CCCH zinc finger 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010207   Gene: ENSOPRG00000011183   Transcript: ENSOPRT00000011179
Sequence length 278
Comment pep:novel genescaffold:pika:GeneScaffold_3069:212213:225783:-1 gene:ENSOPRG00000011183 transcript:ENSOPRT00000011179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDDEVDDSDNEETQEEKIKWGVKLESEQIPKKVKRFGNSTSPPKKPLRIKSRSKDYDTYS
DDDVCAQDSEDTFAQELQQYIKAKEMASATRSFTLPEHSVAEEGVNGAQQATKQKNKKSK
AGQKNGKQKKTKRKWSDTGNKGSNGLPRKKGSQEEDGKPKEKRQPVMSQGFINQHTVVRE
GKQICKYFLERKCIKGDQCKFDHDAEIEKKKMMCKFYVQGYCTRGENCLFLHNEYPCKFY
HTGTKCYQGEYCKFSHAPLTDETRELLARVLDAEKKCK
Download sequence
Identical sequences ENSOPRP00000010207 ENSOPRP00000010207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]