SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000010752 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000010752
Domain Number 1 Region: 5-231
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 5.09e-73
Family Proteasome subunits 0.00000000115
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000010752   Gene: ENSOPRG00000011793   Transcript: ENSOPRT00000011784
Sequence length 232
Comment pep:novel genescaffold:pika:GeneScaffold_2252:207103:215370:-1 gene:ENSOPRG00000011793 transcript:ENSOPRT00000011784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAFAWKATAMGKNYVNGTFLEKRYNEDL
ELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA
Download sequence
Identical sequences ENSOPRP00000010752 ENSOPRP00000010752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]