SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011290 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011290
Domain Number 1 Region: 258-529
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-84
Family Protein kinases, catalytic subunit 0.000000000606
Further Details:      
 
Domain Number 2 Region: 147-291
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-40
Family SH2 domain 0.00000246
Further Details:      
 
Domain Number 3 Region: 68-136,166-195
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000109
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011290   Gene: ENSOPRG00000012369   Transcript: ENSOPRT00000012370
Sequence length 537
Comment pep:novel genescaffold:pika:GeneScaffold_53:559096:622537:-1 gene:ENSOPRG00000012369 transcript:ENSOPRT00000012370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSGRDWW
EARSLTTGXXXXXXXXXXXXXXXXXXXXWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences ENSOPRP00000011290 ENSOPRP00000011290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]