SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011308 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011308
Domain Number 1 Region: 377-508
Classification Level Classification E-value
Superfamily C-type lectin-like 1.5e-34
Family C-type lectin domain 0.00075
Further Details:      
 
Domain Number 2 Region: 176-363
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-30
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 1243-1381
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 4 Region: 1119-1239
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-28
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 5 Region: 955-1102
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-27
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 6 Region: 816-942
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-24
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 7 Region: 41-165
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.84e-20
Family Cysteine rich domain 0.011
Further Details:      
 
Domain Number 8 Region: 651-760
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-18
Family C-type lectin domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSOPRP00000011308
Domain Number - Region: 514-543
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00985
Family C-type lectin domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011308   Gene: ENSOPRG00000012370   Transcript: ENSOPRT00000012388
Sequence length 1462
Comment pep:novel genescaffold:pika:GeneScaffold_2276:215433:324105:-1 gene:ENSOPRG00000012370 transcript:ENSOPRT00000012388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQPGLLLLLLLLLLRVPWGCTEGAPGTGFSREQILQWLEKGIFIIQSESHKTCIQADHS
ILTLKNCERPNKNMLWKWVSNEQLFNIGGSGCLGLNLLKPGPLLHLYECDSAHIFFRWHC
TRRMIMGPGDSMIQARQDNIVVVTWKQLHNWTSYMSDGGDICQHLHKDVYTHKGNARGMP
CVFPFQYNQQWHHECIREGRQDDLLWCATTSRYDRDKKWGFCPDSTSAELGCDVIWEKDP
NTHICYQLNLLSSLSWTEAHSSCQMQGGALLSIMDEAEENFLRKQMSSEAVEVWTGLNQL
DVNVGWQWSDGTPLSYLNWSPETHFEPFVEYHCGTFNSLMPRAWRSRDCESTLPYICEKY
LNHTDDDTVEKDAWKYYATHCEPGWEPYHRNCYKLHKEGKAWNEALHACLSSNSTLADIR
SLAEVEFLITFLGNENASETWIGLSSNTFPVSFEWSNGSSVIFTNWHKLEPQIFPNRSQL
CVSAEQSEGHWKVTNCEETHFYICKRPGHVLSDAESGCSEEWERHGGFCYKIDTVLRSFK
DASNGYYCPPALVTITDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXYNGGGVAIRGKKTTGRWEVKDCRHFKAMSLCKQPENLEETKHEER
WPFHPCFMDWESRPGLASCFKVFHSEKVLMKRSWREAEAFCEEFGAHLASFAHVEEENFV
NELLHSKFNRTEERQFWIGFNKRNPLNSGSWEWSDRTPXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPWLFYHDAEYLFHTYPSEWSSFEF
ACGWLRSDILTIHSAHEQEFIHRKIKALSKYGSNWWIGIQEEEAKNEFRQRGGTPVIYQN
WDKERERSMNNQSQRCAFISSITGLWDIKDCSVSMPSICKRKKFWVIEKEKDTPKKHGTC
PKGWLYFDYKCLLVNIPKDPSSRKNWTYARDSCVAKGGTLVAIESEVEQAFITMNLFGQT
ANVWIGLRNDDYEKWLNGNPVIYSNWSPSDILNIPNYNTTADQNHTPLCALLSSNPNFHF
TGKWYFEDCGKEGYGFICEKMQDSSGHDVNTSDMYPIPNTLEYGNRTYKIIHANMTWYAA
IKSCLMHGAELVSITDQYQQSFLTVILSRLRHAHWIGLFTADNGLHFDWSDGTKSNFTFW
KDEESPFLGDCVFADTNGHWHSTACESFLQGAVCHVPTETRPLEYPELCSETSIPWIKFK
NNCYSFSTVLDGMSFEAAHEFCKKEGSNLLTIKDETENSFLLEELFDFGASVQMVWLNAQ
FDNETIKWFDGTPTDESNWDIRKPDTEHIKAQQCLALKIPEGIWQFSPCQEKMGFICKMT
ADVHTETEHPEKRPSHSIVPLAVALTLVILAVCALSFYMYKQNRGFLRRLAGVGGSYHHT
TSFRSTHLEENILISDLEKNDQ
Download sequence
Identical sequences ENSOPRP00000011308 ENSOPRP00000011308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]