SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOPRP00000011348 from Ochotona princeps 69

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOPRP00000011348
Domain Number 1 Region: 264-532
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-78
Family Protein kinases, catalytic subunit 0.000000000128
Further Details:      
 
Domain Number 2 Region: 151-295
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-39
Family SH2 domain 0.00000125
Further Details:      
 
Domain Number 3 Region: 64-161
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-18
Family SH3-domain 0.0000306
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOPRP00000011348   Gene: ENSOPRG00000012428   Transcript: ENSOPRT00000012430
Sequence length 540
Comment pep:novel genescaffold:pika:GeneScaffold_4398:941305:952446:1 gene:ENSOPRG00000012428 transcript:ENSOPRT00000012430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSSKSKPKDASQRRRSLEQTESTHCGAGSAFPSAQTPSKPASVDGHRGPSTAFTPATAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKERLQIVNNTXXXX
XXEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTF
LVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSK
HADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRV
AIKTLKPGTMSPEAFLQEAQVMKKLRNEKLVQLYAVVSEEPIYIVTEYMSKGSLLDLLKG
ETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLSCKVADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVL
DQVERGYRMPCPPECPESLHDLMCQCWRKEPERPTFEYLQAFLEDYFTATEPQYQPGENL
Download sequence
Identical sequences ENSOPRP00000011348 ENSOPRP00000011348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]